All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (922)
- (1,918)
- (4,393)
- (1)
- (1)
- (3)
- (1)
- (1,243)
- (1,741)
- (820,686)
- (21,508)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,463)
- (3,354)
- (1,862)
- (218)
- (1)
- (8,787)
- (11,949)
- (2,271)
- (4)
- (1)
- (13)
- (67)
- (5)
- (7)
- (2,891)
- (3,877)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,433)
- (464)
- (1)
- (1)
- (136)
- (236)
- (3)
- (1)
- (3)
- (15)
- (96)
- (166,120)
- (203,023)
- (1)
- (22)
- (798)
- (2)
- (11,011)
- (1)
- (126)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (5)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (11)
- (19)
- (5)
- (1)
- (1)
- (10,762)
- (587)
- (1)
- (2)
- (1)
- (8)
- (2)
- (2)
- (321)
- (360)
- (5)
- (13,621)
- (2)
- (4,149)
- (2,250)
- (1)
- (14)
- (29)
- (1)
- (7)
- (5,603)
- (3,961)
- (1)
- (18)
- (1)
- (1)
- (2)
- (17,493)
- (16,747)
- (25)
- (1)
- (1)
- (2)
- (5,498)
- (2)
- (1)
- (32)
- (4)
- (13)
- (76)
- (578)
- (17)
- (2)
- (3)
- (1)
- (1)
- (1)
- (2,083)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (2)
- (104)
- (1)
- (3,869)
- (2)
- (20)
- (3)
- (108)
- (1)
- (5)
- (1)
- (1)
- (5)
- (193)
- (2)
- (4,819)
- (11)
- (2)
- (5)
- (9)
- (4)
- (5)
- (23)
- (110)
- (7,540)
- (35,506)
- (1,381)
- (53)
- (1,544)
- (1)
- (21)
- (7)
- (1)
- (2,048)
- (1)
- (4,315)
- (41)
- (2)
- (1)
- (1)
- (4)
- (37)
- (1)
- (1)
- (797)
- (1)
- (1)
- (2)
- (4)
- (6)
- (3)
- (6)
- (1)
- (1)
- (81)
- (105)
- (722,571)
- (5)
- (5)
- (685,002)
- (31,471)
- (55)
- (547)
- (3)
- (564)
- (2,644)
- (38)
- (1)
- (15)
- (1,629)
- (726)
- (2)
- (2)
- (6)
- (4)
- (5)
- (93,747)
- (62)
- (115)
- (1,920)
- (15,563)
- (187)
- (8)
- (23)
- (521,789)
- (12)
- (1)
- (689,549)
- (72,805)
- (3)
- (38,013)
- (169)
- (1)
- (1)
- (29,616)
- (9)
- (1)
- (25)
- (2,863)
- (74)
- (89)
- (275)
- (2)
- (50)
- (29,592)
- (29,421)
- (6)
- (30,631)
- (16)
- (29,400)
- (45)
- (93)
- (48)
- (29,659)
- (1)
- (30,537)
- (1)
- (3)
- (1)
- (73)
- (29,905)
- (29,598)
- (149)
- (128)
- (36)
- (177)
- (23)
- (125)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,007)
- (11)
- (3)
- (223)
- (764)
- (1,059)
- (718)
- (770)
- (912)
- (882)
- (1,008)
- (845)
- (1,482)
- (913)
- (831)
- (1,049)
- (1,050)
- (1,053)
- (675)
- (1,083)
- (30,363)
- (94)
- (11)
- (44)
- (18)
- (1)
- (147)
- (1)
- (175)
- (3)
- (122)
- (28,455)
- (28,505)
- (28,797)
- (63)
- (28,513)
- (25,119)
- (1)
- (60)
- (28,440)
- (28,099)
- (28,063)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (32,581)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (29,471)
- (1)
- (30,809)
- (26,765)
- (17,685)
- (17,678)
- (26,748)
- (30,809)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (103)
- (11)
- (22)
- (58)
- (26)
- (132)
- (171)
- (25)
- (90)
- (58)
- (14)
- (56)
- (73)
- (9)
- (78)
- (83)
- (99)
- (88)
- (90)
- (16)
- (64)
- (66)
- (42)
- (58)
- (50)
- (53)
- (108)
- (134)
- (41)
- (68)
- (65)
- (88)
- (73)
- (454)
- (30,930)
- (7)
- (4)
- (312)
- (387)
- (2,775)
- (3,699)
- (2)
- (3)
- (37)
- (214)
- (2,662)
- (94)
- (31)
- (27,161)
- (514)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (868)
- (143)
- (796)
- (867)
- (412)
- (333)
- (804)
- (35)
- (712)
- (2)
- (719)
- (781)
- (743)
- (817)
- (629)
- (801)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (12)
- (5)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (474,663)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,507)
- (29,536)
- (29,489)
- (2)
- (36)
- (23)
- (169)
- (830)
- (3)
- (4)
- (403)
- (95)
- (1)
- (1,128)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (140)
- (51)
- (745)
- (1)
- (5)
- (6,852)
- (7,037)
- (2)
- (2)
- (1)
- (27)
- (7)
- (6)
- (161)
- (248)
- (1)
- (74)
- (2)
- (9,420)
- (43)
- (418)
- (173)
- (850)
- (157)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (62)
- (2)
- (23)
- (1)
- (631)
- (55)
- (8)
- (21)
- (90,433)
- (2)
- (2)
- (57)
- (73)
- (265)
- (18)
- (365)
- (3,903)
- (6)
- (2)
- (1,894)
- (6)
- (38)
- (383,027)
- (22)
- (16,920)
- (15,379)
- (1,535)
- (377)
- (219)
- (79)
- (10,155)
- (4)
- (168)
- (17)
- (2)
- (28)
- (25)
- (968)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (89)
- (10)
- (2)
- (290,751)
- (2,434)
- (21,496)
- (63)
- (2)
- (50)
- (14)
- (1)
- (1)
- (4)
- (159)
- (2)
- (17,019)
- (109)
- (2)
- (1)
- (2)
- (150)
- (840)
- (13,124)
- (3)
- (2)
- (143)
- (30)
- (2)
- (2)
- (10)
- (683)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (75)
- (64)
- (3)
- (337)
- (1,391)
- (2,674)
- (4)
- (236,922)
- (136,921)
- (191)
- (50)
- (155,044)
- (453,643)
- (77)
- (1,332)
- (35,295)
- (14)
- (213)
- (12,808)
- (435,614)
- (178)
- (506)
- (2)
- (3)
- (549)
- (6)
- (4)
- (165,694)
- (2,216)
- (26)
- (11)
- (51)
- (461)
- (25)
- (270)
- (1,073)
- (1,354)
- (7)
- (8)
- (1,325)
- (4)
- (2)
- (3)
- (26)
- (6,097)
- (1)
- (6)
- (796)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (42)
- (1,072)
- (2)
- (16)
- (1,628)
- (1)
- (4)
- (2)
- (184)
- (437)
- (201)
- (33)
- (6)
- (35,665)
- (22)
- (1)
- (867)
- (85)
- (496)
- (1,899)
- (5)
- (2)
- (3)
- (2)
- (2)
- (18,658)
- (10)
- (1)
- (4)
- (1,339)
- (3)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,565)
- (105)
- (3)
- (7)
- (21)
- (1,475)
- (1)
- (2)
- (2,734)
- (4,389)
- (3,368)
- (1)
- (41)
- (11)
- (4,363)
- (2)
- (460)
- (431)
- (3)
- (26)
- (14)
- (52)
- (14)
- (2,606)
- (217)
- (1)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (932,689)
- (3)
- (7,914)
- (19)
- (1)
- (45)
- (10)
Filtered Search Results
COX15 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | Q7KZN9-2 |
| Concentration | 1 mg/ml |
| Antigen | COX15 |
| Gene Symbols | COX15 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 |
| Molecular Weight of Antigen | 44 kDa |
| Gene Alias | COX15 (yeast) homolog, cytochrome c oxidase assembly protein, COX15 homolog, cytochrome c oxidase assembly protein (yeast), cytochrome c oxidase assembly protein COX15 homolog, cytochrome c oxidase subunit 15, EC 1.4.4.2, EC 3.1.3.5 |
| Gene ID (Entrez) | 1355 |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Classification | Polyclonal |
| Immunogen | Synthetic peptides corresponding to COX15(COX15 homolog, cytochrome c oxidase assembly protein (yeast)) The peptide sequence was selected from the N terminal of COX15. Peptide sequence DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY. |
| Reconstitution | Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. |
| Primary or Secondary | Primary |
| Test Specificity | Expected identity based on immunogen sequence: Yeast: 82%. |
Invitrogen™ Clostridium botulinum Toxin A VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA0931)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Isotype | VHH |
| Concentration | 1 mg/mL |
| Antigen | Clostridium botulinum Toxin A VHH-8His-Cys-tag |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | 3.4.24.69; BoNT/A; bontA; botA; botulinum; botulinum neurotoxin A; Botulinum neurotoxin type A; botulinum toxin; Botulinum toxin A; Botulinum toxin type A; C. botulinum |
| Product Type | Antibody |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Clostridium botulinum botA/BOTOX. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA0931 |
Invitrogen™ Ricin alpha VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA0991)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Plant |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Gene Accession No. | P02879 |
| Isotype | VHH |
| Concentration | 1 mg/mL |
| Antigen | Ricin alpha VHH-8His-Cys-tag |
| Gene Symbols | LOC8287993 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | matRTA; preRTA; ricin A chain; ricin alpha chain; ricin toxin A chain; rRNA N-glycosidase; rRTA; RTA |
| Gene | LOC8287993 |
| Product Type | Antibody |
| Gene ID (Entrez) | 8287993 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Castor bean Ricin. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA0991 |
Invitrogen™ IL23A VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1160)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA,Surface Plasmon Resonance |
| Form | Liquid |
| Gene Accession No. | Q9NPF7 |
| Isotype | VHH |
| Concentration | 0.82 mg/mL |
| Antigen | IL23A VHH-8His-Cys-tag |
| Gene Symbols | IL23A |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | il 23; IL 23 A; IL12B; Il-12b; Il12p40; Il-12p40; il23; IL-23; IL-23 subunit alpha; IL23A; IL-23A; IL-23-A; IL23P19; IL-23p19; ILN; Interleukin; interleukin 12B; interleukin 23 p19 subunit; interleukin 23 subunit alpha; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; Interleukin-23 subunit p19; interleukin-six, G-CSF related factor; JKA3 induced upon T-cell activation; MGC79388; P19; p40; RP23-388G23.1; SGRF; UNQ2498/PRO5798 |
| Gene | IL23A |
| Product Type | Antibody |
| Gene ID (Entrez) | 51561 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Human IL23A/IL-23 p19. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA1160 |
Invitrogen™ Cholera Toxin Subunit B VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (A9)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA,Neutralization |
| Form | Liquid |
| Isotype | VHH |
| Concentration | 0.76 mg/mL |
| Antigen | Cholera Toxin Subunit B VHH-8His-Cys-tag |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | ctxB; toxB; VC_1456 |
| Product Type | Antibody |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Vibrio cholerae ctxB/Cholera Toxin Subunit B. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | A9 |
Invitrogen™ Clostridium botulinum Toxin B VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA0938)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Isotype | VHH |
| Concentration | 1 mg/mL |
| Antigen | Clostridium botulinum Toxin B VHH-8His-Cys-tag |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | bont/B; bontB; botB; cntB |
| Product Type | Antibody |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Clostridium botulinum BoNT/B. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA0938 |
Invitrogen™ Ricin alpha VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA0984)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Plant |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Gene Accession No. | P02879 |
| Isotype | VHH |
| Concentration | 1 mg/mL |
| Antigen | Ricin alpha VHH-8His-Cys-tag |
| Gene Symbols | LOC8287993 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | matRTA; preRTA; ricin A chain; ricin alpha chain; ricin toxin A chain; rRNA N-glycosidase; rRTA; RTA |
| Gene | LOC8287993 |
| Product Type | Antibody |
| Gene ID (Entrez) | 8287993 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Castor bean Ricin. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA0984 |
Invitrogen™ mCherry VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1128)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Isotype | VHH |
| Concentration | 6.03 mg/mL |
| Antigen | mCherry VHH-8His-Cys-tag |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | mCherry |
| Product Type | Antibody |
| Formulation | PBS with no preservative; pH 7.4 |
| Immunogen | Recombinant mCherry protein. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA1128 |
Invitrogen™ Metapneumovirus Fusion glycoprotein F0 VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA2194)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Virus |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Isotype | VHH |
| Concentration | 1 mg/mL |
| Antigen | Metapneumovirus Fusion glycoprotein F0 VHH-8His-Cys-tag |
| Regulatory Status | RUO |
| Purification Method | Protein A/G |
| Gene Alias | hMPV F0 protein; Viral fusion protein |
| Product Type | Antibody |
| Formulation | PBS with no preservative; pH 7.4 |
| Immunogen | Recombinant HMPV F protein. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA2194 |
Invitrogen™ VWF VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (KB-VWF-D3.1)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Gene Accession No. | P04275 |
| Isotype | VHH |
| Concentration | 1 mg/mL |
| Antigen | VWF VHH-8His-Cys-tag |
| Gene Symbols | VWF |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | 6820430P06Rik; AI551257; B130011O06Rik; C630030D09; Coagulation Factor VIII; coagulation factor VIII VWF; EMBL:CAB37852.1}; F8VWF; factor viii related antigen; von Willebrand antigen 2; von Willebrand antigen II; von Willebrand Disease (vWD); von Willebrand factor; Von Willebrand factor homolog; VWD; vwf; vwf {ECO:0000312 |
| Gene | VWF |
| Product Type | Antibody |
| Gene ID (Entrez) | 7450 |
| Formulation | PBS with no preservative; pH 7.4 |
| Immunogen | Recombinant human VWF protein. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | KB-VWF-D3.1 |
Invitrogen™ Campylobacter jejuni pglK VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (Iv0202)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA,Neutralization |
| Form | Liquid |
| Isotype | VHH |
| Concentration | 1 mg/mL |
| Antigen | Campylobacter jejuni pglK VHH-8His-Cys-tag |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | glycosylation transporter; pglK protein |
| Product Type | Antibody |
| Formulation | PBS with no preservative; pH 7.4 |
| Immunogen | Recombinant Campylobacter jejuni subsp. wlaB/pglK protein. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | Iv0202 |
Invitrogen™ beta Catenin VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1197)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry,Surface Plasmon Resonance |
| Form | Liquid |
| Gene Accession No. | P35222 |
| Isotype | VHH |
| Concentration | 1.54 mg/mL |
| Antigen | beta Catenin VHH-8His-Cys-tag |
| Gene Symbols | CTNNB1 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | armadillo; armadillo homolog; Bcatenin; b-catenin; beta 1 88kDa; beta catenin; Betacatenin; beta-catenin; beta-catenin 1; Bfc; C20orf33; Cadherin associated protein; catenin; catenin (cadherin associated protein), beta 1; catenin (cadherin associated protein), beta 1, 88kDa; catenin (cadherin-associated protein) beta 1; catenin (cadherin-associated protein), beta 1; catenin (cadherin-associated protein), beta 1, 88kDa; Catenin b 1; Catenin b1; catenin beta; catenin beta 1; catenin beta 1 L homeolog; Catenin beta1; Catenin beta-1; Catenin β 1; Catenin β1; Catnb; CHBCAT; CTNB1; CTNNB; ctnnb1; ctnnb1.L; ctnnb1-a; ctnnb1-b; dJ633O20.1; DKFZp686D02253; FLJ25606; FLJ37923; id:ibd2058; Mesc; MRD19; NAP; NYD-SP19; OK/SW-cl.35; OTTHUMP00000209289; P14L; PP8304; PRO2286; RP5-1118M15.1; wu:fb73e10; wu:fi81c06; wu:fk25h01; XELAEV_18031149mg; β catenin; βcatenin |
| Gene | CTNNB1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1499 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Human CTNNB1. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA1197 |
Invitrogen™ Vimentin VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1226)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA,Western Blot,Immunocytochemistry,Surface Plasmon Resonance |
| Form | Liquid |
| Gene Accession No. | P08670 |
| Isotype | VHH |
| Concentration | 1.08 mg/mL |
| Antigen | Vimentin VHH-8His-Cys-tag |
| Gene Symbols | Vim |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | cb28; class-III intermediate microfilament; CTRCT30; epididymis luminal protein 113; FLJ36605; Hel113; intermediate filament; intermediate filament protein; RP11-124N14.1; similar to vimentin; VIM; VIME; Vimentin; vimentin C-terminus |
| Gene | Vim |
| Product Type | Antibody |
| Gene ID (Entrez) | 7431 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Human VIM/Vimentin. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA1226 |
Invitrogen™ Phospholamban Monoclonal Antibody (2D12)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Canine,Chicken,Guinea Pig,Human,Mouse,Sheep,Pig,Rabbit,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P26677, P26678, P61012, P61013, P61014, P61015, P61016 |
| Isotype | IgG2a |
| Concentration | 1 mg/mL |
| Antigen | Phospholamban |
| Gene Symbols | PLN |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | cardiac CMH18; Cardiac phospholamban; CMD1P; CMH18; phospholamban; Plb; Plm; PLN; unnamed protein product |
| Gene | PLN |
| Product Type | Antibody |
| Gene ID (Entrez) | 100009299, 100721387, 101102067, 18821, 396378, 397421, 414755, 5350, 64672 |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | Synthetic peptide corresponding to residues D(2) K V Q Y L T R S A I R R A S T I E M P Q Q A R(25) of canine Phospholamban. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 2D12 |
Invitrogen™ GFP Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Tag |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG |
| Concentration | 2 mg/mL |
| Antigen | GFP |
| Regulatory Status | RUO |
| Purification Method | IgG fraction |
| Gene Alias | GFP; GFP tag; GFP2; green fluorescence; green fluorescent; green fluorescent protein; Turbo eGFP |
| Product Type | Antibody |
| Formulation | PBS with 5mM sodium azide; pH 7.2 |
| Immunogen | The GFP was isolated directly from the jellyfish Aequorea victoria. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |