All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,593)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (52)
- (1)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,876)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (536)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (190,726)
- (288,165)
- (1)
- (19)
- (798)
- (1)
- (12,250)
- (2)
- (129)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,757)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (360)
- (5)
- (13,773)
- (2)
- (4,301)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,038)
- (4,137)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,796)
- (18)
- (1)
- (1)
- (1)
- (5,584)
- (3)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,870)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (188)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,934)
- (37,623)
- (450)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,478)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,161)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,469)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,528)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,961)
- (24,935)
- (24,831)
- (24,992)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,907)
- (11)
- (3)
- (221)
- (761)
- (1,052)
- (714)
- (770)
- (912)
- (879)
- (1,003)
- (843)
- (1,472)
- (906)
- (828)
- (1,052)
- (1,053)
- (1,050)
- (672)
- (1,081)
- (30,490)
- (91)
- (11)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (103)
- (11)
- (22)
- (58)
- (26)
- (132)
- (171)
- (25)
- (90)
- (58)
- (24)
- (56)
- (75)
- (9)
- (78)
- (83)
- (99)
- (88)
- (90)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (108)
- (134)
- (41)
- (68)
- (65)
- (88)
- (75)
- (454)
- (32,847)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (859)
- (141)
- (425)
- (867)
- (405)
- (327)
- (814)
- (35)
- (712)
- (2)
- (715)
- (283)
- (743)
- (815)
- (629)
- (801)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (544,396)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (564)
- (2,913)
- (17)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,671)
- (68)
- (123)
- (2,037)
- (31,295)
- (221)
- (8)
- (23)
- (596,476)
- (16)
- (1)
- (801,791)
- (83,745)
- (3)
- (45,150)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (469)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (1)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,251)
- (43)
- (425)
- (171)
- (2,278)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (678)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (73)
- (275)
- (18)
- (1,253)
- (6,086)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,846)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,092)
- (2,675)
- (43,522)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,498)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,838)
- (4)
- (291,777)
- (153,811)
- (191)
- (53)
- (197,234)
- (502,636)
- (77)
- (1,445)
- (43,045)
- (14)
- (267)
- (12,832)
- (529,587)
- (202)
- (609)
- (2)
- (3)
- (553)
- (6)
- (4)
- (211,744)
- (2,647)
- (27)
- (11)
- (51)
- (526)
- (25)
- (270)
- (1,158)
- (1,424)
- (7)
- (8)
- (1,395)
- (4)
- (2)
- (3)
- (26)
- (6,535)
- (1)
- (6)
- (815)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,223)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (262)
- (437)
- (1,280)
- (39)
- (6)
- (43,454)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,391)
- (9)
- (2)
- (4)
- (136)
- (2)
- (1)
- (2,815)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,667)
- (265)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,082,512)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (5)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,194)
- (51)
- (2)
- (5,116)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,898)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,699)
- (821)
- (2)
- (2)
- (4)
- (3)
- (5)
- (1,336)
- (9,926)
- (376)
- (1,450)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (3)
- (1)
- (18)
- (3)
- (2)
- (1,180)
- (3,513)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,870)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,780)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,491)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,223)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (704)
- (1,434,258)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (24,003)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,797)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,444)
- (5)
- (4)
- (17)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,487)
- (545)
- (215)
- (25)
- (1,235)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,243)
- (532)
- (4)
- (10)
- (2)
- (339,549)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,697)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,893)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (18)
- (82)
- (2,594)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,931)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
His Tag Horseradish Peroxidase-conjugated Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody has been used in 12 publications
| Content And Storage | Do not freeze. 6 months from date of receipt, 2°C to 8°C as supplied. |
|---|---|
| Target Species | Bacteria,E. coli,Liver Fluke,Human,Mouse,Multi-species,Vibrio parahaemolyticus,Yeast |
| Host Species | Mouse |
| Conjugate | HRP |
| Applications | Binding Activity,Bioassay,ELISA Detection (Matched Antibody Pair),ELISA Development,ELISA Development (Detection),Flow Cytometry,Functional Assay,Neutralization,Simple Western,Western Blot |
| Form | Purified |
| Isotype | IgG1 |
| Concentration | LYOPH |
| Antigen | His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Western Blot 1:4000 dilution, Simple Western 1:1000 dilution |
| Gene Alias | 6 His epitope tag, 6X His, 6X-His, H, HHHHHH epitope tag, HHHHHH tag, HIS, His tag, polyHistidine, Poly-histidine |
| Formulation | Supplied as a 0.2 μm filtered solution in Sodium Phosphate and Proclin 300. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with Proclin 300 |
| Immunogen | His-tagged peptide |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | Detects proteins containing accessible consecutive histidine regions. The antibody detects His tags at the amino- or carboxyl-terminus. |
| Clone | AD1.1.10 |
PTH Antibody (PTH/1175) - C-terminus, R&D Systems™
A Novus product, part of R&D Systems. Mouse Monoclonal Antibody
| Content And Storage | Store at 4C. |
|---|---|
| Conjugate | Unconjugated |
| Target Species | Human |
| Host Species | Mouse |
| Applications | Immunohistochemistry |
| Form | Purified |
| Isotype | IgG2b κ |
| Antigen | PTH |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified |
| Gene Alias | Parathormone, Parathyrin, parathyroid hormone, parathyroid hormone 1, PTH1 |
| Formulation | 10mM PBS and 0.05% BSA with 0.05% Sodium Azide |
| Gene ID (Entrez) | 5741 |
| Classification | Monoclonal |
| Immunogen | Recombinant fragment (84 amino acid residues from C-terminus) of human PTH protein |
| Primary or Secondary | Primary |
| Clone | PTH/1175 |
Human IL-2 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody has been used in 14 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human,Mouse,Xenograft |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Bioassay,CyTOF,ELISA Detection (Matched Antibody Pair),Flow Cytometry,Flow Cytometry (Intracellular Staining),Immunocytochemistry,In vivo Assay,Neutralization |
| Form | Purified |
| Isotype | IgG1 |
| Gene Accession No. | NP_000577 |
| Concentration | LYOPH |
| Antigen | IL-2 |
| Gene Symbols | IL2 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Neutralization 0.015-0.03 ug/mL, Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells, Immunocytochemistry 8-25 ug/mL, CyTOF-ready |
| Gene Alias | aldesleukin, IL2, IL-2, IL-2lymphokine, interleukin 2, interleukin-2, involved in regulation of T-cell clonal expansion, Proleukin, T cell growth factor, T-cell growth factor, TCGF |
| Gene ID (Entrez) | 3558 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
| Immunogen | E. coli-derived recombinant human IL-2 Ala21-Thr153 Accession # NP_000577 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human IL-2 in direct ELISAs. Does not cross-react with recombinant IL-2 from mouse, rat, pig, or cotton rat. |
| Clone | 5334 |
| Content And Storage | Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. |
|---|---|
| Target Species | Bacteria |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunofluorescence,Western Blot |
| Form | Serum |
| Isotype | IgG |
| Research Discipline | Signaling |
| Antigen | FtsZ (GTPase) |
| Gene Symbols | FtsZ;BSU15290 |
| Regulatory Status | RUO |
| Purification Method | Unpurified |
| Dilution | Western Blotting Analysis: A representative lot detected FtsZ (GTPase) in Western Blotting applications (Lucet, I., et. al. (2000). EMBO J. 19(7):1467-75; Bisson-Filho, A.W., et. al. (2017). Science. 355(6326):739-743).Immunofluorescence Analysis: A representative lot detected FtsZ (GTPase) in Immunofluorescence applications (Daniel, R.A., et. al. (2000). Mol Microbiol. 35(2):299-311). |
| Gene Alias | Cell division protein FtsZ;Cell Division FtsZ GTPase |
| Gene ID (Entrez) | NP_389412 |
| Formulation | Rabbit polyclonal antiserum with 0.05% sodium azide. |
| Immunogen | Full length purified FtsZ from Bacillus subtilis. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | This rabbit polyclonal antibody detects Cell Division Protein FTsZ in Bacillus subtilis. |
Connexin Antibody Sample Pack
Mouse Polyclonal, Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Antigen | Connexin |
|---|---|
| Purification Method | Affinity Purified |
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Frozen),Western Blot |
| Gene ID (Entrez) | 2697 |
| Classification | Monoclonal/Polyclonal |
| Clone | Sampler Pack |
| Antigen | CD14 |
|---|---|
| Regulatory Status | RUO |
| Content And Storage | Store at 4°C in the dark. |
| Target Species | Equine,Pig |
| Host Species | Mouse |
| Conjugate | FITC |
| Applications | CyTOF,Flow Cytometry,Western Blot |
| Form | Purified |
| Gene ID (Entrez) | 929 |
| Classification | Monoclonal |
| Immunogen | E. coli-derived recombinant porcine CD14 |
| Primary or Secondary | Primary |
| Clone | 433423 |
SARS-CoV-2 Spike RBD Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
|---|---|
| Target Species | SARS-CoV-2 |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Blockade of Receptor-ligand Interaction,ELISA |
| Form | Purified |
| Isotype | IgG2a |
| Gene Accession No. | YP_009724390.1 |
| Antigen | SARS-CoV-2 Spike RBD |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | ELISA, Blockade of Receptor-ligand Interaction 50 ug/mL |
| Gene Alias | 2019-nCoV Peplomer protein, 2019-nCoV S Protein, 2019-nCoV Spike, COVID-19 Spike, E2, Human coronavirus spike glycoprotein, Peplomer protein, S glycoprotein, S protein, SARS-CoV-2, SARS-COV-2 E2, SARS-COV-2 Peplomer protein, SARS-COV-2 S protein, SARS-COV-2 Spike glycoprotein, SARSCOV2 Spike protein, Severe Acute Respiratory Syndrome Coronavirus 2 Spike Protein, Spike, Spike glycoprotein, Spike S1, Spike S1 RBD, surface glycoprotein |
| Gene ID (Entrez) | 43740568 |
| Formulation | Lyophilized from a 0.2 µm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 µm filtered solution in PBS. |
| Immunogen | Spodoptera frugiperda, Sf 21 (baculovirus)-derived SARS-CoV-2 Spike S1 Subunit, Val16-Pro681, Accession # YP_009724390.1 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Clone | 1035740 |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | Q9BYJ9 |
| Concentration | 0.5 mg/ml |
| Antigen | YTHD1 |
| Gene Symbols | YTHDF1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1.0 ug/ml |
| Molecular Weight of Antigen | 61 kDa |
| Gene Alias | C20orf21, DACA-1, Dermatomyositis associated with cancer putative autoantigen 1, FLJ20391, YTH domain family 1, YTH domain family protein 1, YTH domain family, member 1 |
| Gene ID (Entrez) | 54915 |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Classification | Polyclonal |
| Immunogen | Synthetic peptides corresponding to YTHDF1(YTH domain family, member 1) The peptide sequence was selected from the middle region of YTHDF1. Peptide sequence QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA. |
| Reconstitution | Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. |
| Primary or Secondary | Primary |
| Test Specificity | Yeast: 83%. |
Invitrogen™ Ricin alpha VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA0991)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Plant |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Gene Accession No. | P02879 |
| Isotype | VHH |
| Concentration | 1 mg/mL |
| Antigen | Ricin alpha VHH-8His-Cys-tag |
| Gene Symbols | LOC8287993 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | matRTA; preRTA; ricin A chain; ricin alpha chain; ricin toxin A chain; rRNA N-glycosidase; rRTA; RTA |
| Gene | LOC8287993 |
| Product Type | Antibody |
| Gene ID (Entrez) | 8287993 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Castor bean Ricin. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA0991 |
Invitrogen™ Cholera Toxin Subunit B VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (A9)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA,Neutralization |
| Form | Liquid |
| Isotype | VHH |
| Concentration | 0.76 mg/mL |
| Antigen | Cholera Toxin Subunit B VHH-8His-Cys-tag |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | ctxB; toxB; VC_1456 |
| Product Type | Antibody |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Vibrio cholerae ctxB/Cholera Toxin Subunit B. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | A9 |
Invitrogen™ Clostridium botulinum Toxin A VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA0931)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Isotype | VHH |
| Concentration | 1 mg/mL |
| Antigen | Clostridium botulinum Toxin A VHH-8His-Cys-tag |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | 3.4.24.69; BoNT/A; bontA; botA; botulinum; botulinum neurotoxin A; Botulinum neurotoxin type A; botulinum toxin; Botulinum toxin A; Botulinum toxin type A; C. botulinum |
| Product Type | Antibody |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Clostridium botulinum botA/BOTOX. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA0931 |
Invitrogen™ Clostridium botulinum Toxin B VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA0938)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Isotype | VHH |
| Concentration | 1 mg/mL |
| Antigen | Clostridium botulinum Toxin B VHH-8His-Cys-tag |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | bont/B; bontB; botB; cntB |
| Product Type | Antibody |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Clostridium botulinum BoNT/B. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA0938 |
Invitrogen™ HA Tag Monoclonal Antibody (2-2.2.14)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | HA Tag |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | HA; HA Epitope Tag; HA Tag; HA-tag; hemagglutinin |
| Product Type | Antibody |
| Formulation | PBS with 0.05% sodium azide; pH 7.4 |
| Immunogen | HA peptide YPYDVPDYA derivitized to ovalbumin. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 2-2.2.14 |