All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (2)
- (1)
- (3,051)
- (866)
- (1,741)
- (4,062)
- (1)
- (3)
- (1)
- (1,046)
- (625)
- (666,094)
- (11,637)
- (1)
- (549)
- (58)
- (1)
- (27)
- (3,646)
- (2,516)
- (1,447)
- (211)
- (1)
- (6)
- (11,811)
- (1,569)
- (1)
- (4)
- (1)
- (7)
- (67)
- (5)
- (2,702)
- (3,676)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (8)
- (2,593)
- (473)
- (2)
- (7)
- (1)
- (136)
- (237)
- (3)
- (1)
- (11)
- (96)
- (1)
- (160,126)
- (193,757)
- (1)
- (24)
- (3)
- (798)
- (2)
- (10,342)
- (1)
- (123)
- (1)
- (4)
- (11)
- (4)
- (18)
- (1)
- (2)
- (5)
- (34)
- (3)
- (1)
- (39)
- (4)
- (1)
- (108)
- (1)
- (20)
- (11)
- (19)
- (6)
- (1)
- (10,861)
- (589)
- (1)
- (2)
- (9)
- (2)
- (2)
- (328)
- (361)
- (1)
- (5)
- (12,212)
- (2)
- (4,709)
- (1)
- (14)
- (7)
- (5,409)
- (4,423)
- (1)
- (19)
- (1)
- (1)
- (2)
- (17,461)
- (16,139)
- (27)
- (1)
- (2)
- (5,037)
- (1)
- (32)
- (3)
- (13)
- (77)
- (610)
- (17)
- (2)
- (1)
- (1)
- (1)
- (2,082)
- (1)
- (14)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (2)
- (104)
- (1)
- (3,911)
- (2)
- (20)
- (5)
- (109)
- (1)
- (5)
- (1)
- (1)
- (5)
- (198)
- (2)
- (8,810)
- (12)
- (2)
- (5)
- (9)
- (4)
- (1)
- (24)
- (109)
- (7,818)
- (33,237)
- (1,381)
- (53)
- (1,545)
- (21)
- (7)
- (1)
- (2,175)
- (1)
- (4,382)
- (24)
- (2)
- (1)
- (1)
- (7)
- (4)
- (38)
- (1)
- (1)
- (1)
- (710)
- (1)
- (1)
- (3)
- (4)
- (14)
- (3)
- (6)
- (1)
- (1)
- (100)
- (105)
- (644,360)
- (5)
- (11)
- (573,275)
- (24,418)
- (60)
- (544)
- (3)
- (565)
- (2,319)
- (38)
- (1)
- (15)
- (1,515)
- (2)
- (2)
- (6)
- (4)
- (5)
- (72,927)
- (47)
- (161)
- (1,702)
- (13,753)
- (110)
- (8)
- (23)
- (463,069)
- (8)
- (1)
- (587,591)
- (67,991)
- (30,557)
- (171)
- (1)
- (1)
- (23,468)
- (9)
- (1)
- (20)
- (2,764)
- (74)
- (89)
- (275)
- (2)
- (53)
- (25,224)
- (24,973)
- (5)
- (26,171)
- (12)
- (24,986)
- (45)
- (93)
- (47)
- (25,295)
- (1)
- (26,032)
- (1)
- (3)
- (1)
- (71)
- (25,451)
- (25,234)
- (84)
- (89)
- (31)
- (98)
- (18)
- (123)
- (5)
- (103)
- (102)
- (2)
- (92)
- (1)
- (15)
- (5)
- (28,553)
- (10)
- (3)
- (222)
- (774)
- (1,032)
- (697)
- (760)
- (899)
- (866)
- (999)
- (842)
- (1,418)
- (889)
- (826)
- (1,039)
- (1,048)
- (1,039)
- (678)
- (1,049)
- (27,213)
- (123)
- (18)
- (61)
- (20)
- (1)
- (147)
- (1)
- (163)
- (1)
- (122)
- (23,486)
- (23,556)
- (23,941)
- (63)
- (23,510)
- (19,377)
- (1)
- (60)
- (23,452)
- (23,126)
- (23,074)
- (17)
- (9)
- (1)
- (1)
- (9)
- (5)
- (27,616)
- (5)
- (31)
- (1)
- (1)
- (338)
- (740)
- (24,354)
- (1)
- (27,752)
- (21,263)
- (17,684)
- (17,677)
- (21,257)
- (27,752)
- (38)
- (1)
- (4)
- (9)
- (12)
- (2)
- (103)
- (11)
- (22)
- (58)
- (28)
- (132)
- (171)
- (25)
- (90)
- (48)
- (53)
- (64)
- (9)
- (78)
- (84)
- (99)
- (88)
- (90)
- (54)
- (56)
- (34)
- (48)
- (50)
- (53)
- (109)
- (134)
- (41)
- (68)
- (65)
- (88)
- (62)
- (454)
- (24,671)
- (7)
- (4)
- (313)
- (311)
- (2,695)
- (3,523)
- (2)
- (3)
- (37)
- (210)
- (2,600)
- (94)
- (29)
- (22,993)
- (449)
- (533)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,230)
- (839)
- (161)
- (691)
- (784)
- (707)
- (727)
- (780)
- (713)
- (688)
- (690)
- (645)
- (12)
- (29)
- (116)
- (6)
- (274)
- (251)
- (125)
- (126)
- (94)
- (46)
- (14)
- (5)
- (5)
- (9)
- (3)
- (10)
- (2)
- (64)
- (14)
- (437,485)
- (7)
- (188)
- (49)
- (2)
- (367)
- (71)
- (46)
- (25)
- (271)
- (3)
- (3)
- (4)
- (20,066)
- (20,051)
- (20,017)
- (94)
- (727)
- (414)
- (90)
- (5)
- (800)
- (113)
- (3)
- (1)
- (4,474)
- (1,003)
- (26)
- (4,499)
- (176)
- (391)
- (159)
- (6)
- (3)
- (13)
- (208)
- (59,215)
- (1)
- (93)
- (223)
- (150)
- (2,508)
- (2)
- (703)
- (327,274)
- (13,014)
- (12,564)
- (8,835)
- (50)
- (25)
- (126)
- (9)
- (262,591)
- (315)
- (9,779)
- (5)
- (6)
- (6)
- (1)
- (4)
- (19)
- (12,785)
- (23)
- (1)
- (197)
- (169)
- (7,196)
- (67)
- (4)
- (2)
- (98)
- (15)
- (29)
- (36)
- (3,095)
- (1,977)
- (216,714)
- (60,464)
- (156)
- (58)
- (171,301)
- (345,730)
- (77)
- (699)
- (27,991)
- (40)
- (12,811)
- (342,819)
- (19)
- (1)
- (86)
- (463)
- (93,924)
- (386)
- (11)
- (49)
- (320)
- (22)
- (312)
- (421)
- (169)
- (1,061)
- (26)
- (5,135)
- (606)
- (5)
- (6)
- (129)
- (254)
- (9)
- (319)
- (1,063)
- (34)
- (6)
- (30,483)
- (1)
- (118)
- (16)
- (1,673)
- (46)
- (7,350)
- (2)
- (1)
- (317)
- (1)
- (87)
- (1,285)
- (13)
- (3)
- (16)
- (1,641)
- (1,084)
- (800)
- (658)
- (2,618)
- (468)
- (87)
- (7)
- (4)
- (2,052)
- (193)
- (1)
- (5)
- (1)
- (791,409)
- (4)
- (1,362)
- (1)
- (18)
Filtered Search Results
Invitrogen™ CD11b Monoclonal Antibody (M1/70), Alexa Fluor™ 532, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Alexa Fluor 532 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P05555 |
| Isotype | IgG2b κ |
| Concentration | 0.2 mg/mL |
| Antigen | CD11b |
| Gene Symbols | ITGAM |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | antigen CD11b (p170); antigen CD11b (p170); macrophage antigen alpha polypeptide; CD11 antigen-like family member B; CD11b; CD11B (p170); CD11b/CD18; cell surface glycoprotein MAC-1 alpha subunit; cell surface glycoprotein MAC-1 subunit alpha; complement component 3 receptor 3 subunit; complement component receptor 3 alpha-a; complement receptor type 3; CR3; CR-3 alpha chain; CR3A; F730045J24Rik; integrin alpha M; integrin alpha-M; integrin subunit alpha M; integrin, alpha M; integrin, alpha M (complement component 3 receptor 3 subunit); ITGAM; Leukocyte adhesion receptor MO1; leukocyte integrin alpha-M chain; LOC100351865; Ly-40; MAC1; Mac-1; Mac-1 alpha; Mac-1 alpha (Mac1A); MAC-1 alpha subunit; MAC1A; Mac-1a; macrophage antigen alpha; macrophage antigen alpha polypeptide; MGC117044; MO1A; Neutrophil adherence receptor; neutrophil adherence receptor alpha-M subunit; SLEB6; unnamed protein product |
| Gene | ITGAM |
| Product Type | Antibody |
| Gene ID (Entrez) | 16409 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | M1/70 |
CD11c Monoclonal Antibody (N418), Alexa Fluor™ 532, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Armenian Hamster Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Armenian Hamster |
| Conjugate | Alexa Fluor 532 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG |
| Gene Accession No. | Q9QXH4 |
| Concentration | 0.2 mg/mL |
| Antigen | CD11c |
| Gene Symbols | Itgax |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin, alpha X (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6 |
| Gene | Itgax |
| Product Type | Antibody |
| Gene ID (Entrez) | 16411 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | N418 |
Invitrogen™ VMA2 Monoclonal Antibody (13D11B2)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Yeast |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | VMA2 |
| Gene Symbols | VMA2 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | ATP6B1; ATP6V1B1; ATPase H+ transporting V1 subunit B1; ATPase, H transporting, lysosomal V1 subunit B1; ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta 56/58 kDa, isoform 1; ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 1; ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1; ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1 (Renal tubular acidosis with deafness); ATPase, H+ transporting, lysosomal V1 subunit B1; ATPase, H+ transporting, V1 subunit B, isoform 1; AW208839; D630003L15; D630030L16Rik; D630039P21Rik; endomembrane proton pump 58 kDa subunit; H(+)-transporting two-sector ATPase, 58kD subunit; H+-ATPase beta 1 subunit; lysosomal 56/58kDa; RTA1B; vacuolar H+-ATPase; vacuolar proton pump 3; vacuolar proton pump subunit B 1; vacuolar proton pump, subunit 3; VATB; V-ATPase B1; V-ATPase B1 subunit; V-ATPase subunit B 1; VMA2; VPP3; Vpp-3; V-type proton ATPase subunit B, kidney isoform |
| Gene | VMA2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 852424 |
| Formulation | HEPES buffered saline with 0.02% sodium azide |
| Immunogen | Purified S. cerevisiae vacuole membranes. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 13D11B2 |
BD Biosciences HLA-DR Mouse anti-Human, RB780, Clone: G46-6 (also known as L243), BD Horizon™
Mouse Monoclonal Antibody
| Content And Storage | Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze. The monoclonal antibody was purified from tissue culture supernatant or ascites by affinity chromatography. The antibody was conjugated to the dye under optimum conditions and unreacted dye was removed. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | RB780 |
| Applications | Flow Cytometry |
| Form | Purified |
| Isotype | IgG2a κ |
| Antigen | HLA-DR |
| Regulatory Status | RUO |
| Purification Method | Affinity Chromatography |
| Gene Alias | MHC class II antigen; HLA class II histocompatibility antigen |
| Formulation | Aqueous buffered solution containing ≤0.09% sodium azide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | G46-6 (also known as L243) |
HSP60 Antibody (LK2), DyLight 594, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Peroxiredoxin 2 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Conjugate | Unconjugated |
| Target Species | Human,Rat,Bovine,Canine,Equine,Guinea Pig,Goat,Rabbit,Sheep,Yeast,Zebrafish |
| Host Species | Rabbit |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin),Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Antigen | Peroxiredoxin 2 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Gene Alias | EC 1.11.1, MGC4104, Natural killer cell-enhancing factor B, natural killer-enhancing factor B, NKEFBNKEF-B, peroxiredoxin 2, peroxiredoxin-2, PRPTDPX1, PRX2, PRXII, thiol-specific antioxidant 1, Thiol-specific antioxidant protein, Thioredoxin peroxidase 1, Thioredoxin-dependent peroxide reductase 1, torin, TPX1, TSAEC 1.11.1.15 |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Gene ID (Entrez) | 7001 |
| Classification | Polyclonal |
| Immunogen | Synthetic peptides corresponding to PRDX2(peroxiredoxin 2) The peptide sequence was selected from the middle region of PRDX2. Peptide sequence VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD. |
| Primary or Secondary | Primary |
Hexokinase 2 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store lyophilized antibody at 4°C. Aliquot reconstituted liquid and store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Applications | Western Blot,ELISA,Immunohistochemistry |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | P04806 |
| Concentration | LYOPH |
| Antigen | Hexokinase 2 |
| Regulatory Status | RUO |
| Formulation | 0.02 M Potassium Phosphate, 0.15 M Sodium Chloride, pH 7.2 with 0.01% Sodium Azide |
| Gene ID (Entrez) | 3099 |
| Classification | Polyclonal |
| Immunogen | Hexokinase 2 Antibody was produced by repeated immunizations with yeast hexokinase protein. (Uniprot: P04806) |
| Reconstitution | Reconstitute with 100 ul deionized water (or equivalent) |
| Primary or Secondary | Primary |
YTHD1 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Invitrogen™ Pma1p Monoclonal Antibody (40B7)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Yeast |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P05030 |
| Isotype | IgG |
| Concentration | Conc. Not Determined |
| Antigen | Pma1p |
| Gene Symbols | PMA1 |
| Regulatory Status | RUO |
| Gene Alias | PMA1 |
| Gene | PMA1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 852876 |
| Formulation | Cell culture media with 5mM sodium azide |
| Immunogen | Yeast nuclear prep. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 40B7 |
Invitrogen™ Saccharomyces cerevisiae MHT1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C or -80°C if preferred |
|---|---|
| Target Species | Yeast |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | Q12525 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | Saccharomyces cerevisiae MHT1 |
| Gene Symbols | MHT1 |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | Hcy S-methyltransferase 1; homocysteine methyltransferase 1; Homocysteine S-methyltransferase 1; L0552; MHT1; S-adenosylmethionine-homocysteine S-methyltransferase MHT1; S-methylmethionine; S-methylmethionine:homocysteine methyltransferase 1; SMM; SMM:Hcy S-methyltransferase 1; YLL062C |
| Gene | MHT1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 850664 |
| Formulation | PBS with 50% glycerol and 0.03% ProClin 300; pH 7.4 |
| Immunogen | Recombinant Saccharomyces cerevisiae Homocysteine S-methyltransferase 1 protein (1-324aa). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
PFKFB2 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Host Species | Rabbit |
|---|---|
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | NP_032851 |
| Antigen | PFKFB2 |
| Gene Symbols | PFKFB2 |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 57 kDa |
| Gene Alias | 6PF-2-K/Fru-2,6-P2ase 2, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2, DKFZp781D2217, fructose-2,6-bisphosphatase, cardiac isozyme, MGC138308,6PF-2-K/Fru-2,6-P2ase heart-type isozyme, MGC138310, PFK/FBPase 2, PFK-2/FBPase-2, PFKFB, cardiac |
| Gene ID (Entrez) | 5208 |
| Immunogen | Synthetic peptide directed towards the C terminal of human Pfkfb2The immunogen for this antibody is Pfkfb2. Peptide Sequence: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ GAPDH Loading Control Monoclonal Antibody (GA1R)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Canine,Rabbit,Hamster,Chicken,Yeast,Bacteria,Insect |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O14556, P00356, P04406, P04797, P16858, P17244, P46406, Q28259, Q64467, Q9ESV6 |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | GAPDH Loading Control |
| Gene Symbols | GAPDH, GAPDHS |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 38 kDa BFA-dependent ADP-ribosylation substrate; aging-associated gene 9 protein; BARS-38; bb02e05; cb350; cb609; CDABP0047; EC 1.2.1.12; epididymis secretory protein Li 278; epididymis secretory sperm binding protein Li 162eP; fb71f08; fk58c09; G3PD; G3PDH; GAPD; GAPD2; gapdh; GAPDH2; GAPDH-2; GAPDHS; Gapds; Gapd-s; glceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase, testis-specific; glyceraldehyde phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase (G3PDH); glyceraldehyde-3-phosphate dehydrogenase 2; glyceraldehyde-3-phosphate dehydrogenase GAPDH; glyceraldehyde-3-phosphate dehydrogenase like-17 protein; glyceraldehyde-3-phosphate dehydrogenase type 2; glyceraldehyde-3-phosphate dehydrogenase, spermatogenic; glyceraldehyde-3-phosphate dehydrogenase, testis-specific; glyceraldehyde-phosphate-dehydrogenase; glycerine aldehyde 3-phosphate dehydrogenase; HEL-S-162eP; HEL-S-278; HGNC:4141; HSD35; HSD-35; I79_001391; KNC-NDS6; LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase, testis-specific; mg:bb02e05; MGC128279 protein; MGC88685; multifunctional protein, glycolytic enzyme; OK/SW-cl.12; Peptidyl-cysteine S-nitrosylase GAPDH; similar to glyceraldehyde 3-phosphate dehydrogenase; spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2; Spermatogenic glyceraldehyde-3-phosphate dehydrogenase; Unknown (protein for IMAGE:8101613); unnamed protein product; wu:fb33a10; wu:fb71f08; wu:fk58c09; wu:ft80f05; zgc:76908 |
| Gene | GAPDHS |
| Product Type | Antibody |
| Gene ID (Entrez) | 100009074, 100352213, 100736557, 100767862, 14433, 14447, 24383, 2597, 26330, 374193, 403755, 476483, 66020 |
| Formulation | PBS with no preservative; pH 7.2 |
| Immunogen | Recombinant GAPDH. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | GA1R |
Invitrogen™ GFP Monoclonal Antibody (GF28R)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | GFP |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | GFP; GFP tag; GFP2; green fluorescence; green fluorescent; Turbo eGFP |
| Product Type | Antibody |
| Formulation | PBS with no preservative; pH 7.2 |
| Immunogen | GFP from the jellyfish Aequorea Victoria N-terminal peptide-KLH conjugated. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | GF28R |
Invitrogen™ 6x-His Tag Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Tag |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG |
| Concentration | 2 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | Synthetic peptide corresponding to residues H H H H H H. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ DYKDDDDK Tag Monoclonal Antibody (FG4R)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | DYKDDDDK Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | DDDDK; DDDDK epitope tag; ECS epitope tag; ECS tag; FLAG; FLAG Tag |
| Product Type | Antibody |
| Formulation | PBS with no preservative; pH 7.2 |
| Immunogen | Synthetic peptide (DYKDDDDK) coupled to KLH. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | FG4R |